Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PPP1R14D/GBPI-1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP185484 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP185484 0.1 mL
NB406558 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP185484 Supplier Novus Biologicals Supplier No. NBP185484
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

PPP1R14D/GBPI-1 Polyclonal specifically detects PPP1R14D/GBPI-1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen PPP1R14D/GBPI-1
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200-1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias CPI17-like, FLJ20251, gastrointestinal and brain-specific PP1-inhibitory protein 1, GBPI, GBPI1, GBPI-1, gut and brain phosphatase inhibitor 1, MGC119014, MGC119016, PKC-dependent PP1 inhibitory protein, protein phosphatase 1 regulatory subunit 14D, protein phosphatase 1, regulatory (inhibitor) subunit 14D
Gene Symbols PPP1R14D
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:ENPCKKVHWASGRRRTSSTDSESKSHPDSSKIPRSRRPSRLTVKYDRGQLQRWLEMEQWVDAQVQELFQDQATPSEPEIDLEALMDLSTEEQKTQLEAILGNCP
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 54866
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.