PPP1R3B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP182243

Catalog No. NBP182243

Description

PPP1R3B Polyclonal specifically detects PPP1R3B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PPP1R3B
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: FLJ14005, FLJ34675, GL, Hepatic glycogen-targeting protein phosphatase 1 regulatory subunit GL, PPP1R4PP1 subunit R4, protein phosphatase 1 regulatory subunit 3B, Protein phosphatase 1 regulatory subunit 4, Protein phosphatase 1 subunit GL, protein phosphatase 1, regulatory (inhibitor) subunit 3B
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: PPP1R3B
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:DRDTFSFDISLPEKIQSYERMEFAVYYECNGQTYWDSNRGKNYRIIRAELKSTQGMTKPHSGPDLGISFDQFGSPRCSYGLF
• Quantity: 0.1 mL
• Research Discipline: metabolism
• Gene ID (Entrez): 79660
• Target Species: Human
• Isotype: IgG

For Research Use Only