PPP2R2A Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB124795	Novus Biologicals NBP309947100UL	100 μg

Description

PPP2R2A Polyclonal specifically detects PPP2R2A in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PPP2R2A
• Applications: Western Blot
• Conjugate: Unconjugated
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: B55A, B55ALPHA, DKFZp686N05117, FLJ26613, FLJ41727, MGC52248, PP2A subunit B isoform alpha, PP2A subunit B isoform B55-alpha, PP2A subunit B isoform PR55-alpha, PP2A subunit B isoform R2-alpha, PR52A, PR55A, protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), alphaisoform, protein phosphatase 2 (formerly 2A), regulatory subunit B (PR52), alpha isoform, protein phosphatase 2 (formerly 2A), regulatory subunit B, alpha isoform, protein phosphatase 2, regulatory subunit B, alpha, serine/threonine protein phosphatase 2A, 55 KDA regulatory subunit B, alphaisoform, serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alphaisoform
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human 2ABA. Peptide sequence SERDKRPEGYNLKEEDGRYRDPTTVTTLRVPVFRPMDLMVEASPRRIFAN
• Purification Method: Affinity purified

• Dilution: Western Blot 1.0 ug/ml
• Classification: Polyclonal
• Form: Purified
• Regulatory Status: RUO
• Formulation: PBS buffer, 2% sucrose
• Gene ID (Entrez): 5520
• Primary or Secondary: Primary
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.