PPP2R3A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Catalog Number	Mfr. No.	Quantity
NB431499	Novus Biologicals NBP18723325UL	25 μL
NBP187233	Novus Biologicals NBP187233	0.1 mL

Description

PPP2R3A Polyclonal specifically detects PPP2R3A in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

• Antigen: PPP2R3A
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 5523
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:EQRDPFAVQKDVENDGPEPSDWDRFAAEEYETLVAEESAQAQFQEGFEDYETDEPASPSEFGNKSNKILSASLPEKCGKLQSVDEE
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human, Mouse, Rat
• Gene Alias: PP2A subunit B isoform R3 isoform, PP2A subunit B isoforms B72/B130, PP2A subunit B isoforms B'-PR72/PR130, protein phosphatase 2 (formerly 2A), regulatory subunit B' (PR 72), alphaisoform and (PR 130), beta isoform, protein phosphatase 2 (formerly 2A), regulatory subunit B', alpha, protein phosphatase 2, regulatory subunit B', alpha, serine/threonine-protein phosphatase 2A regulatory subunit B' subunit alpha, subunit B, R3 isoform
• Gene Symbols: PPP2R3A
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only