Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PPP2R4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP187232
Description
PPP2R4 Polyclonal specifically detects PPP2R4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| PPP2R4 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20-1:50 | |
| EC 5.2.1.8, MGC2184, Phosphotyrosyl phosphatase activator, PP2A, PP2A phosphatase activator, PP2A subunit B' isoform PR53, PP2A, subunit B', PR53 isoform, protein phosphatase 2A activator, regulatory subunit 4, regulatory subunit B' (PR 53), serine/threonine-protein phosphatase 2A activator, Serine/threonine-protein phosphatase 2A regulatory subunit 4, Serine/threonine-protein phosphatase 2A regulatory subunit B' | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of human PPP2R4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| PPP2R4 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:KLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKF | |
| 0.1 mL | |
| Protein Phosphatase | |
| 5524 | |
| Human, Mouse, Rat | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction