Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PPP2R5D Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP188959
Description
PPP2R5D Polyclonal specifically detects PPP2R5D in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
PPP2R5D | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
MGC2134, MGC8949, PP2A B subunit isoform B56-delta, PP2A B subunit isoform B'-delta, PP2A B subunit isoform PR61-delta, PP2A B subunit isoform R5-delta, PP2A, B subunit, B' delta isoform, PP2A, B subunit, B56 delta isoform, PP2A, B subunit, PR61 delta isoform, PP2A, B subunit, R5 delta isoform, protein phosphatase 2, regulatory subunit B', delta, regulatory subunit B (B56), delta isoform, regulatory subunit B', delta isoform, Serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, deltaisoform, serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
PPP2R5D | |
This antibody was developed against Recombinant Protein corresponding to amino acids:DCTQQYKAEKQKGRFRMKEREEMWQKIEELARLNPQYPMFRAPPPLPPVYSMETETPTAEDIQLLKRTVETEAVQMLKDIKKEKVLLRRKSELPQDVY | |
0.1 mL | |
Neuroscience, Wnt Signaling Pathway | |
5528 | |
Human, Mouse, Rat | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction