PPP3CC Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP325065

Catalog No. NB301387

Description

PPP3CC Polyclonal antibody specifically detects PPP3CC in Human samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence

Specifications

• Antigen: PPP3CC
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
• Gene Alias: Calcineurin, testis-specific catalytic subunit, Calmodulin-dependent calcineurin A subunit gamma isoform, CALNA3CAM-PRP catalytic subunit, CNA3, EC 3.1.3.16, PP2Bgamma, protein phosphatase 2B, catalytic subunit, gamma isoform, protein phosphatase 3 (formerly 2B), catalytic subunit, gamma isoform, protein phosphatase 3 (formerly 2B), catalytic subunit, gamma isoform(calcineurin A gamma), protein phosphatase 3, catalytic subunit, gamma isozyme, serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein PPP3CC using the following amino acid sequence: RAHEAQDAGYRMYRKSQATGFPSLITIFSAPNYLDVYN
• Quantity: 100 μL
• Research Discipline: B Cell Development and Differentiation Markers, Cell Biology, Cytoskeleton Markers, Immunology, Neurodegeneration, Neuroscience, Signal Transduction
• Gene ID (Entrez): 5533
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunocytochemistry
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified