Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PPPDE2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $646.00
Specifications
| Antigen | PPPDE2 |
|---|---|
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PPPDE2 Polyclonal specifically detects PPPDE2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| PPPDE2 | |
| Polyclonal | |
| Rabbit | |
| Proteases & Other Enzymes | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 27351 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: IMLGKQLEGIWHTSIVVHKDEFFFGSGGISSCPPGGTLLGPPDSVVDVGSTEVTEE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| D15Wsu75e, DJ347H13.4, FAM152B, family with sequence similarity 152, member B, MGC138384, PPPDE peptidase domain containing 2, PPPDE peptidase domain-containing protein 2, Protein FAM152B | |
| DESI1 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title