Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Novus Biologicals™ PPPDE2 Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Supplier: Novus Biologicals™ NBP247324PEP
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DESI1. The PPPDE2 Recombinant Protein Antigen is derived from E. coli. The PPPDE2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.Specifications
27351 | |
Chromatography | |
0.5mg/mL | |
PBS and 1M Urea, pH 7.4. | |
DESI1 | |
23kDa | |
0.1mL | |
Proteases & Other Enzymes | |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-47324. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
Human | |
>80% | |
Store at -20°C. Avoid freeze-thaw cycles. | |
Blocking/Neutralizing, Control | |
Unlabeled | |
PPPDE2 | |
RUO | |
E.Coli | |
IMLGKQLEGIWHTSIVVHKDEFFFGSGGISSCPPGGTLLGPPDSVVDVGSTEVTEE |
Safety and Handling
ShelfLife : 365
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?
Product Content Correction