Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIMA549231

Invitrogen™ PPT1 Monoclonal Antibody (10F3)
GREENER_CHOICE

Catalog No. PIMA549231
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIMA549231 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIMA549231 Supplier Invitrogen™ Supplier No. MA549231
Add to Cart
Add to Cart

Description

Mouse Monoclonal Antibody

Adding 0.2 mL of distilled water will yield a concentration of 500 μg/mL. Immunogen sequence is different from the related mouse and rat sequences by four amino acids. Positive Control - WB: human K562 whole cell, human HepG2 whole cell, human Hela whole cell. IHC: human intestinal cancer tissue, human lung cancer tissue, human mammary cancer tissue. Flow: THP-1 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

The protein encoded by this gene is a small glycoprotein involved in the catabolism of lipid-modified proteins during lysosomal degradation. The encoded enzyme removes thioester-linked fatty acyl groups such as palmitate from cysteine residues. Defects in this gene are a cause of infantile neuronal ceroid lipofuscinosis 1 (CLN1, or INCL) and neuronal ceroid lipofuscinosis 4 (CLN4). Two transcript variants encoding different isoforms have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Antigen PPT1
Applications Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot
Classification Monoclonal
Clone 10F3
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene Ppt1
Gene Accession No. P50897
Gene Alias 3.1.2.22; 9530043G02Rik; AA960502; C77813; ceroid-palmitoyl-palmitoyl-protein thioesterase 1; CLN1; D4Ertd184e; INCL; Palmitoyl-protein hydrolase 1; palmitoyl-protein thioesterase; palmitoyl-protein thioesterase 1; palmitoyl-protein thioesterase 1 (ceroid-lipofuscinosis, neuronal 1, infantile); PPT; Ppt1; PPT-1; QnpA-18851; unnamed protein product
Gene Symbols Ppt1
Host Species Mouse
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human PPT1 (191-224aa KEDVYRNHSIFLADINQERGINESYKKNLMALKK).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 5538
Target Species Human
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG2b
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.