Invitrogen™ PPT1 Monoclonal Antibody (10F3)

Mouse Monoclonal Antibody

Supplier:  Invitrogen™ MA549231

Catalog No. PIMA549231

Description

Adding 0.2 mL of distilled water will yield a concentration of 500 μg/mL. Immunogen sequence is different from the related mouse and rat sequences by four amino acids. Positive Control - WB: human K562 whole cell, human HepG2 whole cell, human Hela whole cell. IHC: human intestinal cancer tissue, human lung cancer tissue, human mammary cancer tissue. Flow: THP-1 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

The protein encoded by this gene is a small glycoprotein involved in the catabolism of lipid-modified proteins during lysosomal degradation. The encoded enzyme removes thioester-linked fatty acyl groups such as palmitate from cysteine residues. Defects in this gene are a cause of infantile neuronal ceroid lipofuscinosis 1 (CLN1, or INCL) and neuronal ceroid lipofuscinosis 4 (CLN4). Two transcript variants encoding different isoforms have been found for this gene.

Specifications

• Antigen: PPT1
• Classification: Monoclonal
• Concentration: 500 μg/mL
• Formulation: PBS with 4 mg trehalose and 0.05 mg sodium azide
• Gene Accession No.: P50897
• Gene Symbols: Ppt1
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PPT1 (191-224aa KEDVYRNHSIFLADINQERGINESYKKNLMALKK).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2b

• Applications: Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot
• Clone: 10F3
• Conjugate: Unconjugated
• Gene: Ppt1
• Gene Alias: 3.1.2.22; 9530043G02Rik; AA960502; C77813; ceroid-palmitoyl-palmitoyl-protein thioesterase 1; CLN1; D4Ertd184e; INCL; Palmitoyl-protein hydrolase 1; palmitoyl-protein thioesterase; palmitoyl-protein thioesterase 1; palmitoyl-protein thioesterase 1 (ceroid-lipofuscinosis, neuronal 1, infantile); PPT; Ppt1; PPT-1; QnpA-18851; unnamed protein product
• Host Species: Mouse
• Purification Method: Antigen Affinity Chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 5538
• Content And Storage: -20°C
• Form: Lyophilized