Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA579860

Invitrogen™ PPT1 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579860
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579860 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579860 Supplier Invitrogen™ Supplier No. PA579860
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat brain tissue, mouse brain tissue, rat liver tissue, mouse liver tissue, HEPG2 whole cell, 293T whole cell, MCF-7 whole cell. IHC: human intestinal cancer tissue. Flow: U937 cell, SiHa cell, THP-1 cell.

The protein encoded by this gene is a small glycoprotein involved in the catabolism of lipid-modified proteins during lysosomal degradation. The encoded enzyme removes thioester-linked fatty acyl groups such as palmitate from cysteine residues. Defects in this gene are a cause of infantile neuronal ceroid lipofuscinosis 1 (CLN1, or INCL) and neuronal ceroid lipofuscinosis 4 (CLN4). Two transcript variants encoding different isoforms have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Antigen PPT1
Applications Flow Cytometry, Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene Ppt1
Gene Accession No. O88531, P45479, P50897
Gene Alias 3.1.2.22; 9530043G02Rik; AA960502; C77813; ceroid-palmitoyl-palmitoyl-protein thioesterase 1; CLN1; D4Ertd184e; INCL; Palmitoyl-protein hydrolase 1; palmitoyl-protein thioesterase; palmitoyl-protein thioesterase 1; palmitoyl-protein thioesterase 1 (ceroid-lipofuscinosis, neuronal 1, infantile); PPT; Ppt1; PPT-1; QnpA-18851; unnamed protein product
Gene Symbols Ppt1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human PPT1 (191-224aa KEDVYRNHSIFLADINQERGINESYKKNLMALKK).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 19063, 29411, 5538
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.