Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PR48 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15817420UL
Description
PR48 Polyclonal specifically detects PR48 in Human samples. It is validated for Western Blot.Specifications
PR48 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q9Y5P8 | |
PPP2R3B | |
Synthetic peptides corresponding to PPP2R3B(protein phosphatase 2 (formerly 2A), regulatory subunit B'', beta) The peptide sequence was selected from the C terminal of PPP2R3B. Peptide sequence ELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALR | |
20 μL | |
Cell Cycle and Replication | |
28227 | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
FLJ60425, NYREN8, NY-REN-8 antigen, PP2A subunit B isoform PR48, PP2A, subunit B, PR48 isoform, PPP2R3L, PPP2R3LY, PR48, protein phosphatase 2 (formerly 2A), regulatory subunit B'', beta, protein phosphatase 2, regulatory subunit B'', beta, Protein phosphatase 2A 48 kDa regulatory subunit, serine/threonine protein phosphatase 2A, 48kDa regulatory subunit B, serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
This product is specific to Subunit or Isoform: B. | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction