Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PRAMEF10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | PRAMEF10 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PRAMEF10 Polyclonal specifically detects PRAMEF10 in Human samples. It is validated for Western Blot.Specifications
PRAMEF10 | |
Polyclonal | |
Rabbit | |
O60809 | |
343071 | |
Synthetic peptides corresponding to PRAMEF10(PRAME family member 10) The peptide sequence was selected from the middle region of PRAMEF10. Peptide sequence DLLRHTGGLSKLGLELYPAPLESLDYKGHVNWEILTPIRAELMRTLREVR. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
MGC138413, MGC138415, PRAME family member 10, RP5-845O24.7 | |
PRAMEF10 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title