PRAS40 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP325066

Catalog No. NB301386

Description

PRAS40 Polyclonal antibody specifically detects PRAS40 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: PRAS40
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: 40 kDa, AKT1 substrate 1 (proline-rich), MGC2865, proline-rich AKT1 substrate 1,40 kDa proline-rich AKT substrate
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein PRAS40 using the following amino acid sequence: REDNEEDEDEPTETETSGEQLGISDNGGLFVMDEDATLQDLPPFCESDPESTDDGSLSEETPAGPPTCSVPPASALPTQQY
• Quantity: 100 μL
• Research Discipline: Apoptosis, Autophagy, Cancer, Growth and Development, Lipid and Metabolism, mTOR Pathway, Neuronal Cell Markers, Neuroscience, Phospho Specific, Tumor Suppressors
• Gene ID (Entrez): 84335
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified