Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PRAS40 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | PRAS40 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
Description
PRAS40 Polyclonal specifically detects PRAS40 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| PRAS40 | |
| Unconjugated | |
| RUO | |
| Q96B36 | |
| 84335 | |
| Synthetic peptides corresponding to AKT1S1(AKT1 substrate 1 (proline-rich)) The peptide sequence was selected from the C terminal of AKT1S1. Peptide sequence KSLPVSVPVWGFKEKRTEARSSDEENGPPSSPDLDRIAASMRALVLREAE. | |
| Primary |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Autophagy, Cancer, Growth and Development, Lipid and Metabolism, mTOR Pathway, Neuronal Cell Markers, Neuroscience, Tumor Suppressors | |
| 40 kDa, AKT1 substrate 1 (proline-rich), MGC2865, proline-rich AKT1 substrate 1,40 kDa proline-rich AKT substrate | |
| AKT1S1 | |
| IgG | |
| 27 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title