Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PRDM13 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | PRDM13 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP18036020
![]() |
Novus Biologicals
NBP18036020UL |
20 μL |
Each for $206.00
|
|
|||||
NBP180360
![]() |
Novus Biologicals
NBP180360 |
100 μL |
Each for $487.50
|
|
|||||
Description
PRDM13 Polyclonal specifically detects PRDM13 in Human samples. It is validated for Western Blot.Specifications
PRDM13 | |
Polyclonal | |
Rabbit | |
NP_067633 | |
59336 | |
Synthetic peptide directed towards the N terminal of human PRDM13. Peptide sequence HGAARAPATSVSADCCIPAGLRLGPVPGTFKLGKYLSDRREPGPKKKVRM. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
PR domain containing 13, PR domain zinc finger protein 13 | |
PRDM13 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title