Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PRDM15 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | PRDM15 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PRDM15 Polyclonal specifically detects PRDM15 in Human samples. It is validated for Western Blot.Specifications
PRDM15 | |
Polyclonal | |
Rabbit | |
C21orf83, chromosome 21 open reading frame 83, PFM15, PR domain containing 15, PR domain zinc finger protein 15, PR domain-containing protein 15, Zinc finger protein 298, ZNF298 | |
PRDM15 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
63977 | |
Synthetic peptides corresponding to PRDM15(PR domain containing 15) The peptide sequence was selected from the middle region of PRDM15. Peptide sequence LCGTKVSTRASMSRHMRRKHPEVLAVRIDDLDHLPETTTIDASSIGIVQP. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title