PRDM9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP180118

Catalog No. NBP180118

Description

PRDM9 Polyclonal specifically detects PRDM9 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PRDM9
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 2.1.1.43, histone-lysine N-methyltransferase PRDM9, minisatellite binding protein 3 (115kD), minisatellite binding protein 3, 115kDa, PFM6MEISETZ, PR domain containing 9, PR domain zinc finger protein 9, PR domain-containing protein 9, PRMD9, ZNF899
• Host Species: Rabbit
• Molecular Weight of Antigen: 103 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: NP_064612
• Gene Symbols: PRDM9
• Immunogen: Synthetic peptide directed towards the middle region of human PRDM9. Peptide sequence CPGDQNQEQQYPDPHSRNDKTKGQEIKERSKLLNKRTWQREISRAFSSPP.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 56979
• Target Species: Human
• Isotype: IgG

For Research Use Only