Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PREB Antibody, Novus Biologicals™
SDP

Catalog No. NB418550 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB418550 25 μL
NBP187057 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB418550 Supplier Novus Biologicals Supplier No. NBP18705725UL
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

PREB Polyclonal specifically detects PREB in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen PREB
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias MGC3467, prolactin regulatory binding-element protein, prolactin regulatory element binding, prolactin regulatory element-binding protein, SEC12Mammalian guanine nucleotide exchange factor mSec12
Gene Symbols PREB
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:REAHGIVVTDVAFLPEKGRGPELLGSHETALFSVAVDSRCQLHLLPSRRSVP
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Transcription Factors and Regulators
Primary or Secondary Primary
Gene ID (Entrez) 10113
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Rat, Mouse, Rat
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.