PREB Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP310311100UL

Catalog No. NB125523

Description

PREB Polyclonal specifically detects PREB in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PREB
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
• Gene Alias: MGC3467, prolactin regulatory binding-element protein, prolactin regulatory element binding, prolactin regulatory element-binding protein, SEC12Mammalian guanine nucleotide exchange factor mSec12
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PREB (NP_037520). Peptide sequence RVENLQAVQTDFSSDPLQKVVCFNHDNTLLATGGTDGYVRVWKVPSLEKV
• Quantity: 100 μg
• Research Discipline: Transcription Factors and Regulators
• Gene ID (Entrez): 10113
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified