Learn More
Description
Specifications
Specifications
| Antigen | PREB |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | MGC3467, prolactin regulatory binding-element protein, prolactin regulatory element binding, prolactin regulatory element-binding protein, SEC12Mammalian guanine nucleotide exchange factor mSec12 |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PREB (NP_037520). Peptide sequence RVENLQAVQTDFSSDPLQKVVCFNHDNTLLATGGTDGYVRVWKVPSLEKV |
| Purification Method | Affinity purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
