Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PREB Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP310311100UL

 View more versions of this product

Catalog No. NB125523


Add to cart

Description

Description

PREB Polyclonal specifically detects PREB in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

PREB
Unconjugated
PBS buffer, 2% sucrose
MGC3467, prolactin regulatory binding-element protein, prolactin regulatory element binding, prolactin regulatory element-binding protein, SEC12Mammalian guanine nucleotide exchange factor mSec12
The immunogen is a synthetic peptide directed towards the N terminal region of human PREB (NP_037520). Peptide sequence RVENLQAVQTDFSSDPLQKVVCFNHDNTLLATGGTDGYVRVWKVPSLEKV
100 μg
Transcription Factors and Regulators
Primary
10113
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
Purified
Rabbit
Affinity purified
RUO
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Polyclonal
Human
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit