Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PRELID2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$499.50
Specifications
Antigen | PRELID2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PRELID2 Polyclonal specifically detects PRELID2 in Human samples. It is validated for Western Blot.Specifications
PRELID2 | |
Polyclonal | |
Rabbit | |
Q8N945 | |
153768 | |
Synthetic peptides corresponding to PRELID2(PRELI domain containing 2) The peptide sequence was selected from the C terminal of PRELID2. Peptide sequence GRISITGVGFLNCVLETFASTFLRQGAQKGIRIMEMLLKEQCGAPLAE. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
FLJ38376, MGC21644, PRELI domain containing 2, PRELI domain-containing protein 2 | |
PRELID2 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title