PRMT6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP232459

Catalog No. NBP232459

Description

PRMT6 Polyclonal specifically detects PRMT6 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PRMT6
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: EC 2.1.1.-, EC 2.1.1.125, FLJ10559, FLJ51477, Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 6, Histone-arginine N-methyltransferase PRMT6, HMT1 hnRNP methyltransferase-like 6, HMT1 hnRNP methyltransferase-like 6 (S. cerevisiae), HRMT1L6, protein arginine methyltransferase 6, protein arginine N-methyltransferase 6
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: PRMT6
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: WKQALLYLNEPVQVEQDTDVSGEITLLPSRDNPRRLRVLLRYKVGDQEEKTKDFAME
• Quantity: 0.1 mL
• Research Discipline: Chromatin Research, Signal Transduction
• Gene ID (Entrez): 55170
• Target Species: Human
• Isotype: IgG

For Research Use Only