Profilin 2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP18742625UL

Catalog No. NB406072

Description

Profilin 2 Polyclonal specifically detects Profilin 2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Profilin 2
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence validated from a verified customer review., Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: D3S1319E, PFL, profilin 2, Profilin II, profilin-2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of human Profilin 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: PFN2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:QEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLTLGAKKCSVIRD
• Quantity: 25 μL
• Research Discipline: Cytoskeleton Markers, Signal Transduction, Stem Cell Markers
• Gene ID (Entrez): 5217
• Target Species: Human, Mouse, Rat
• Isotype: IgG

For Research Use Only