Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Profilin 2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication
Supplier: Novus Biologicals NBP187426
Description
Profilin 2 Polyclonal specifically detects Profilin 2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
Profilin 2 | |
Polyclonal | |
Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence validated from a verified customer review., Immunohistochemistry-Paraffin 1:50 - 1:200 | |
D3S1319E, PFL, profilin 2, Profilin II, profilin-2 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of human Profilin 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
PFN2 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:QEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLTLGAKKCSVIRD | |
0.1 mL | |
Cytoskeleton Markers, Signal Transduction, Stem Cell Markers | |
5217 | |
Human, Mouse, Rat | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction