Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Prolactin Antibody (CL6550), Novus Biologicals™

Prolactin Antibody (CL6550), Novus Biologicals™
SDP

Catalog No. NBP276502 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP276502 100 μL
NB402766 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP276502 Supplier Novus Biologicals Supplier No. NBP276502
Only null left
Add to Cart
Add to Cart

Description

Mouse Monoclonal Antibody

Prolactin Monoclonal specifically detects Prolactin in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen Prolactin
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone CL6550
Conjugate Unconjugated
Dilution Western Blot 1 ug/ml, Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide
Gene Alias prolactin
Gene Symbols PRL
Host Species Mouse
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: TEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNN
Purification Method Protein A purified
Quantity 100 μL
Research Discipline Biologically Active Proteins, Cancer, Phospho Specific, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 5617.0
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2b
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.