Learn More
Description
- Easily Screen and Profile PDK1 Kinase Inhibitors
- Includes kinase, substrate and reaction buffer
- Use with ADP-Glo™ Assay for bioluminescent detection of kinase activity
Specifications
Specifications
| For Use With (Application) | For research use |
| Includes | 10μg Recombinant PDK1 Kinase, PDKtide ([protein fragment, 39 aa]) Substrate, Reaction Buffer, DTT and MnCl2 |
| Molecular Weight (g/mol) | 67 |
| Content And Storage | <−65°C |
| Product Type | PDK1 Kinase Enzyme system |
| Quantity | 10 μg |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.