Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Promega PDK1 Kinase Enzyme System

Catalog No. PRV2761
Click to view available options
Quantity:
1/Ea.
10 μg
Content And Storage:
<−65°C
COMPONENTS AT DIFFERENT TEMPS

Recombinant full-length human PDK1 was expressed by baculovirus in Sf9 insect cells using an N-terminal His tag. PDK1 (3-phosphoinositide-dependent protein kinase) is activated by the presence of PtdIns(3,4,5)P3 or PtdIns(3,4)P2.

  • Easily Screen and Profile PDK1 Kinase Inhibitors
  • Includes kinase, substrate and reaction buffer
  • Use with ADP-Glo™ Assay for bioluminescent detection of kinase activity

Specifications

For Use With (Application) For research use
Includes 10μg Recombinant PDK1 Kinase, PDKtide (KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC) Substrate, Reaction Buffer, DTT and MnCl2
Molecular Weight (g/mol) 67
Content And Storage <−65°C
Product Type PDK1 Kinase Enzyme system
Quantity 10 μg
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.