Invitrogen™ Properdin Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA595544

Catalog No. PIPA595544

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human placenta tissue, human U-937 whole cell, rat brain tissue, mouse brain tissue. IHC: human cholangiocarcinoma tissue, human liver cancer tissue, human placenta tissue, mouse kidney tissue, rat liver tissue, rat intestine tissue. Flow: THP-1 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

This gene encodes a plasma glycoprotein that positively regulates the alternative complement pathway of the innate immune system. This protein binds to many microbial surfaces and apoptotic cells and stabilizes the C3- and C5-convertase enzyme complexes in a feedback loop that ultimately leads to formation of the membrane attack complex and lysis of the target cell. Mutations in this gene result in two forms of properdin deficiency, which results in high susceptibility to meningococcal infections.

Specifications

• Antigen: Properdin
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: CFP
• Gene Alias: BCFG; Bf; BFD; C3 Proaccelerator; C3/C5 convertase; cfb; CFP; Complement factor P; complement factor properdin; GBG; H2-Bf; PBF2; PFC; PFD; PROPERDIN; properdin factor, complement; properdin P factor, complement
• Host Species: Rabbit
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 18636, 299314, 5199
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Flow Cytometry, Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: P11680, P27918
• Gene Symbols: CFP
• Immunogen: A synthetic peptide corresponding to a sequence of human CFP (MVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKR).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG