Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Prostasin/Prss8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Prostasin/Prss8 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Prostasin/Prss8 Polyclonal specifically detects Prostasin/Prss8 in Human samples. It is validated for Western Blot.Specifications
Prostasin/Prss8 | |
Polyclonal | |
Rabbit | |
Q16651 | |
5652 | |
Synthetic peptides corresponding to PRSS8 (protease, serine, 8) The peptide sequence was selected from the middle region of PRSS8. Peptide sequence PITFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLE. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
CAP1, channel-activating protease 1, EC 3.4.21, EC 3.4.21.-, EC 3.4.21.120, PROSTASIN, protease, serine, 8, Serine protease 8 | |
PRSS8 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title