PSP94/MSMB Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP198455

Catalog No. NBP198455

Description

PSP94/MSMB Polyclonal specifically detects PSP94/MSMB in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Prostate Secretory Protein/PSP
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: beta-microseminoprotein, IGBFProstate secreted seminal plasma protein, immunoglobulin binding factor, Immunoglobulin-binding factor, microseminoprotein, beta-, MSP, MSPB, PN44Prostate secretory protein of 94 amino acids, prostatic secretory protein 94, PRPS, PRSP, PSP, PSP57, PSP94HPC13, PSP-94Seminal plasma beta-inhibin
• Host Species: Rabbit
• Molecular Weight of Antigen: 11 kDa
• Quantity: 100 μL
• Research Discipline: Cancer
• Gene ID (Entrez): 4477
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_002434
• Gene Symbols: MSMB
• Immunogen: The immunogen for this antibody is Prostate Secretory Protein/PSP. Peptide sequence ETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWI.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.