Prosurfactant Protein C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP160117

Catalog No. NBP160117

Description

Prosurfactant Protein C Polyclonal specifically detects Prosurfactant Protein C in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Prosurfactant Protein C
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: PSP-C, pulmonary surfactant-associated protein C, Pulmonary surfactant-associated proteolipid SPL(Val), SFTP2, SFTP2pulmonary surfactant apoprotein-2 SP-C, SMDP2surfactant, pulmonary-associated protein C, SP-CSP5, surfactant protein C
• Host Species: Rabbit
• Molecular Weight of Antigen: 21 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10 - 1:500, Immunohistochemistry-Paraffin 1:10 - 1:500
• Gene Accession No.: P11686
• Gene Symbols: SFTPC
• Immunogen: Synthetic peptide corresponding to SFTPC (surfactant, pulmonary-associated protein C). The peptide sequence was selected from the N terminal of SFTPC. Peptide sequence MDVGSKEVLMESPPDYSAAPRGRFGIPCCPVHLKRLLIVVVVVVLIVVVI. The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6440
• Target Species: Human, Mouse, Rat, Canine, Equine, Guinea Pig, Rabbit, Sheep
• Isotype: IgG