Proteasome 20S alpha 5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB431661	Novus Biologicals NBP18683725UL	25 μL
NBP186837	Novus Biologicals NBP186837	0.1 mL

Description

Proteasome 20S alpha 5 Polyclonal specifically detects Proteasome 20S alpha 5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Proteasome 20S alpha 5
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Core ESC Like Genes, Stem Cell Markers
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 5686
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:ARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCD
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: EC 3.4.25.1, FLJ42315, macropain subunit zeta, Macropain zeta chain, MGC117302, MGC125802, MGC125803, MGC125804, Multicatalytic endopeptidase complex zeta chain, proteasome (prosome, macropain) subunit, alpha type, 5, proteasome alpha 5 subunit, proteasome component 5, proteasome subunit alpha type-5, proteasome subunit zeta, Proteasome zeta chain, PSC5, ZETA
• Gene Symbols: PSMA5
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only