Proteasome 20S beta2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP192294

Catalog No. NBP192294

Description

Proteasome 20S beta2 Polyclonal specifically detects Proteasome 20S beta2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Proteasome 20S beta2
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: EC 3.4.25.1, HC7-I, Macropain subunit C7-I, MGC104215, MGC126885, multicatalytic endopeptidase complex subunit C7-1, Multicatalytic endopeptidase complex subunit C7-I, proteasome (prosome, macropain) subunit, beta type, 2, proteasome beta 2 subunit, Proteasome component C7-I, proteasome subunit beta type-2, proteasome subunit, beta type, 2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of human Proteasome 20S beta2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: PSMB2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:LLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTF
• Quantity: 0.1 mL
• Research Discipline: Proteases & Other Enzymes
• Gene ID (Entrez): 5690
• Target Species: Human, Mouse, Rat
• Isotype: IgG

For Research Use Only