Protein Disulfide Isomerase/P4HB Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157949

Catalog No. NBP157949

Description

Protein Disulfide Isomerase/P4HB Polyclonal antibody specifically detects Protein Disulfide Isomerase/P4HB in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).

Specifications

• Antigen: Protein Disulfide Isomerase/P4HB
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Cellular thyroid hormone-binding protein, collagen prolyl 4-hydroxylase beta, DSI, ERBA2L, GIT, glutathione-insulin transhydrogenase, P4Hbeta, p55, PDIA1procollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase), betapolypeptide (protein disulfide isomerase-associated 1), PDIEC 5.3.4.1, PHDB, PO4DB, PO4HB, procollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase), betapolypeptide, PROHBprocollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase), betapolypeptide (protein disulfide isomerase; thyroid hormone binding protein p55), Prolyl 4-hydroxylase subunit beta, prolyl 4-hydroxylase, beta polypeptide, protein disulfide isomerase family A, member 1, protein disulfide isomerase/oxidoreductase, protein disulfide isomerase-associated 1, protein disulfide-isomerase, protocollagen hydroxylase, thyroid hormone-binding protein p55
• Host Species: Rabbit
• Molecular Weight of Antigen: 55 kDa
• Quantity: 100 μL
• Research Discipline: Cellular Markers, ER Markers, Fibroblast Cell Markers, Hypoxia
• Gene ID (Entrez): 5034
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: P07237
• Gene Symbols: P4HB
• Immunogen: Synthetic peptides corresponding to Protein Disulfide Isomerase/P4HB (procollagen-proline, 2-oxoglutarate 4-dioxygenase, beta polypeptide) The peptide sequence was selected from the N terminal of Protein Disulfide Isomerase/P4HB. Peptide sequence TIKFFRNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLPDGAAAESLV The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Human: 100%; Mouse: 100%; Canine: 85%; Xenopus: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

For Research Use Only