Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Protein mab-21-like 1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$499.50
Specifications
| Antigen | Protein mab-21-like 1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Protein mab-21-like 1 Polyclonal specifically detects Protein mab-21-like 1 in Human samples. It is validated for Western Blot.Specifications
| Protein mab-21-like 1 | |
| Polyclonal | |
| Rabbit | |
| Q13394 | |
| 4081 | |
| Synthetic peptides corresponding to MAB21L1(mab-21-like 1 (C. elegans)) The peptide sequence was selected from the N terminal of MAB21L1. Peptide sequence IAAQAKLVYHLNKYYNEKCQARKAAIAKTIREVCKVVSDVLKEVEVQEPR. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| CAGR1mab-21 (C. elegans)-like 1, FLJ10197, mab-21-like 1 (C. elegans), mab-21-like protein 1, protein mab-21-like 1 | |
| MAB21L1 | |
| IgG | |
| 41 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title