Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Antibody, Novus Biologicals™

Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Antibody, Novus Biologicals™
SDP

Catalog No. p-200043537 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB418109 25 μL
NBP190311 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB418109 Supplier Novus Biologicals Supplier No. NBP19031125UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody has been used in 3 publications

Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Polyclonal specifically detects Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen Protein O-Glucosyltransferase 1/POGLUT1/KTELC1
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500-1:1000
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias 9630046K23Rik, C3orf9, CAP10-like protein, 46 kDa, chromosome 3 open reading frame 9, CLP46, EC 2.4.1.-, hCLP46CAP10-like 46 kDa protein, KDELC family like 1, KDELCL1, KTEL (Lys-Tyr-Glu-Leu) containing 1, KTEL motif-containing protein 1, MDS010, MDSRPKTELC1, MGC32995, Myelodysplastic syndromes relative protein, protein O-glucosyltransferase 1, Rumi, x 010 protein
Gene Symbols POGLUT1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:VQELLQFVKANDDVAQEIAERGSQFIRNHLQMDDITCYWENLLSEYSKFLSYNVTRRKGYDQIIPKMLKTEL
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Developmental Biology
Primary or Secondary Primary
Gene ID (Entrez) 56983
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.