Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Protocadherin-18 Antibody, Novus Biologicals™

Protocadherin-18 Antibody, Novus Biologicals™
SDP

Catalog No. NBP17931520 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP17931520 20 μL
NBP179315 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP17931520 Supplier Novus Biologicals Supplier No. NBP17931520UL

Description

Rabbit Polyclonal Antibody

Protocadherin-18 Polyclonal specifically detects Protocadherin-18 in Human samples. It is validated for Western Blot.

Specifications

Antigen Protocadherin-18
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_061908
Gene Alias protocadherin 18
Gene Symbols PCDH18
Host Species Rabbit
Immunogen Synthetic peptide directed towards the N terminal of human PCDH18The immunogen for this antibody is PCDH18. Peptide sequence MHQMNAKMHFRFVFALLIVSFNHDVLGKNLKYRIYEEQRVGSVIARLSED.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 54510
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.