Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Protocadherin-18 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | Protocadherin-18 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179315
|
Novus Biologicals
NBP179315 |
100 μL |
Each for $480.74
|
|
|||||
|
NBP17931520
|
Novus Biologicals
NBP17931520UL |
20 μL | N/A | N/A | N/A | ||||
Description
Protocadherin-18 Polyclonal specifically detects Protocadherin-18 in Human samples. It is validated for Western Blot.Specifications
| Protocadherin-18 | |
| Polyclonal | |
| Rabbit | |
| NP_061908 | |
| 54510 | |
| Synthetic peptide directed towards the N terminal of human PCDH18The immunogen for this antibody is PCDH18. Peptide sequence MHQMNAKMHFRFVFALLIVSFNHDVLGKNLKYRIYEEQRVGSVIARLSED. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| protocadherin 18 | |
| PCDH18 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title