Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PRPF3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | PRPF3 |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PRPF3 Polyclonal specifically detects PRPF3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
PRPF3 | |
Polyclonal | |
Rabbit | |
Vision | |
hPrp3, HPRP3P, HPRP3retinitis pigmentosa 18 (autosomal dominant), Pre-mRNA-splicing factor 3, PRP3, PRP3 pre-mRNA processing factor 3 homolog (S. cerevisiae), PRP3 pre-mRNA processing factor 3 homolog (yeast), Prp3p, RP18, U4/U6 small nuclear ribonucleoprotein Prp3, U4/U6 snRNP 90 kDa protein, U4/U6-associated RNA splicing factor | |
PRPF3 | |
IgG | |
Affinity Purified |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
9129 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PSSSQPERLPIGNTIQPSQAATFMNDAIEKARKAAELQARIQAQLALKPGLIGNANMVGLANLHAMGIAPPKVELKDQTKPTPLILDEQ | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title