PRPS1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB438266	Novus Biologicals NBP21381325UL	25ul
NBP213813	Novus Biologicals NBP213813	0.1 mL

Description

PRPS1 Polyclonal specifically detects PRPS1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PRPS1
• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: CMTX5ARTS, deafness, X-linked 2, perceptive, congenital, DFN2, DFNX1KIAA0967, dJ1070B1.2 (phosphoribosyl pyrophosphate synthetase 1), EC 2.7.6.1, Phosphoribosyl pyrophosphate synthase I, phosphoribosyl pyrophosphate synthetase 1, PPRibP, PRSI, PRS-I, ribose-phosphate diphosphokinase 1, ribose-phosphate pyrophosphokinase 1
• Gene Symbols: PRPS1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Apoptosis, Core ESC Like Genes, Lipid and Metabolism, Stem Cell Markers
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 5631
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LHASQIQVSVEAKYWCLKGGRKGLMMLKTAEKP
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only