Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PRR18 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | PRR18 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PRR18 Polyclonal specifically detects PRR18 in Human samples. It is validated for Western Blot.Specifications
PRR18 | |
Polyclonal | |
Rabbit | |
Human | |
285800 | |
Synthetic peptides corresponding to PRR18(proline rich region 18) The peptide sequence was selected from the N terminal of PRR18. Peptide sequence RPPQRPEGLLSSSWPSATLKRPPARRGPGLDRTQPPAPPGVSPQALPSRA. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
proline rich 18 | |
PRR18 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title