Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PRR20A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP24685725UL
Description
PRR20A Polyclonal antibody specifically detects PRR20A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
PRR20A | |
Polyclonal | |
Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
P86481 | |
Rabbit | |
Immunogen affinity purified | |
RUO | |
122183 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2), 40% Glycerol | |
Proline-rich protein 20A;Proline-rich protein 20B;Proline-rich protein 20C;Proline-rich protein 20D;Proline-rich protein 20E;PRR20;PRR20B;PRR20C;PRR20D;PRR20E | |
This antibody was developed against Recombinant Protein corresponding to amino acids: MEEPRPSKRLRSMAPNQASGGPPPEPGCCVADPEGSVEADGPAQPAQPAKPIAYVKPFRRQP | |
25 μL | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction