Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PRRG3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | PRRG3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PRRG3 Polyclonal specifically detects PRRG3 in Human samples. It is validated for Western Blot.Specifications
PRRG3 | |
Polyclonal | |
Rabbit | |
Q9BZD7 | |
79057 | |
Synthetic peptides corresponding to PRRG3(proline rich Gla (G-carboxyglutamic acid) 3 (transmembrane)) The peptide sequence was selected from the N terminal of PRRG3. Peptide sequence EEICSYEEVKEVFENKEKTMEFWKGYPNAVYSVRDPSQSSDAMYVVVPLL. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
PRGP3MGC156177, proline rich Gla (G-carboxyglutamic acid) 3 (transmembrane), Proline-rich gamma-carboxyglutamic acid protein 3, Proline-rich Gla protein 3, TMG3MGC149510, transmembrane gamma-carboxyglutamic acid protein 3 | |
PRRG3 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title