Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PSG-1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

$436.00

Specifications

Antigen PSG1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Form Purified
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP158028
View Documents
Novus Biologicals
NBP158028
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

PSG1 Polyclonal specifically detects PSG1 in Human samples. It is validated for Western Blot.
Specifications

Specifications

PSG1
Polyclonal
Purified
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
B1G1CD66 antigen-like family member F, CD66f, CD66f antigen, DHFRP2, Fetal liver non-specific cross-reactive antigen 1/2, FLJ90598, FLJ90654, FL-NCA-1/2, PBG1, pregnancy specific beta-1-glycoprotein 1, pregnancy-specific B-1 glycoprotein, Pregnancy-specific beta-1 glycoprotein C/D, pregnancy-specific beta-1-glycoprotein 1, Pregnancy-specific glycoprotein 1, PS-beta-C/D, PS-beta-G-1, PSBG-1, PSBG1SP1, PSGGAPSG95, PSGIIA
PSG1
IgG
Protein A purified
47 kDa
Western Blot
Unconjugated
Rabbit
Human
Q6ICR4
5669
Synthetic peptides corresponding to PSG1(pregnancy specific beta-1-glycoprotein 1) The peptide sequence was selected from the C terminal of PSG1. Peptide sequence YLSCSADSNPPAQYSWTINEKFQLPGQKLFIRHITTKHSGLYVCSVRNSA.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit