Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PSG1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$499.50

Specifications

Antigen	PSG1
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Form	Purified

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP158028 View Documents View Product Certificates	Novus Biologicals NBP158028	100 μL	Each of 1 for $499.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

PSG1 Polyclonal specifically detects PSG1 in Human samples. It is validated for Western Blot.

Specifications

Antigen	PSG1
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Gene Accession No.	Q6ICR4
Gene ID (Entrez)	5669
Immunogen	Synthetic peptides corresponding to PSG1(pregnancy specific beta-1-glycoprotein 1) The peptide sequence was selected from the C terminal of PSG1. Peptide sequence YLSCSADSNPPAQYSWTINEKFQLPGQKLFIRHITTKHSGLYVCSVRNSA.
Primary or Secondary	Primary
Molecular Weight of Antigen	47 kDa

Applications	Western Blot
Conjugate	Unconjugated
Host Species	Rabbit
Target Species	Human
Gene Alias	B1G1CD66 antigen-like family member F, CD66f, CD66f antigen, DHFRP2, Fetal liver non-specific cross-reactive antigen 1/2, FLJ90598, FLJ90654, FL-NCA-1/2, PBG1, pregnancy specific beta-1-glycoprotein 1, pregnancy-specific B-1 glycoprotein, Pregnancy-specific beta-1 glycoprotein C/D, pregnancy-specific beta-1-glycoprotein 1, Pregnancy-specific glycoprotein 1, PS-beta-C/D, PS-beta-G-1, PSBG-1, PSBG1SP1, PSGGAPSG95, PSGIIA
Gene Symbols	PSG1
Isotype	IgG
Purification Method	Protein A purified

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

PSG1 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents