PSG5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157973

Catalog No. NBP157973

Description

PSG5 Polyclonal specifically detects PSG5 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PSG5
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Fetal liver non-specific cross-reactive antigen 3, FL-NCA-3PSG, pregnancy specific beta-1-glycoprotein 5, pregnancy-specific beta 1 glycoprotein, pregnancy-specific beta-1 glycoprotein, pregnancy-specific beta-1-glycoprotein 5, Pregnancy-specific beta-1-glycoprotein-5, Pregnancy-specific glycoprotein 5, PS-beta-G-5, PSBG-5
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%.
• Target Species: Human, Mouse, Rat, Canine, Equine
• Form: Purified

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q15238
• Gene Symbols: PSG5
• Immunogen: Synthetic peptides corresponding to PSG5(pregnancy specific beta-1-glycoprotein 5) The peptide sequence was selected from the N terminal of PSG5. Peptide sequence QLMDLYHYITSYVVDGQINIYGPAYTGRETVYSNASLLIQNVTREDAGSY.
• Quantity: 100 μL
• Research Discipline: Immunology
• Gene ID (Entrez): 5673
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG