Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PSMA2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	Proteasome 20S alpha 2
Applications	Western Blot, Immunohistochemistry
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP154633 missing translation for 'viewDocuments' missing translation for 'viewProductCertificates' missing translation for 'viewAlternatives' missing translation for 'toSaveUpto'	Novus Biologicals NBP154633	100 μL	Each of 1 for $487.50	Only null left	Sign In or Register to check your price. Add to Cart

Description

PSMA2 Polyclonal specifically detects PSMA2 in Human samples. It is validated for Western Blot.

Specifications

Antigen	Proteasome 20S alpha 2
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Stem Cell Markers
Gene Alias	EC 3.4.25.1, HC3PSC2, Macropain subunit C3, MU, Multicatalytic endopeptidase complex subunit C3, PMSA2, proteasome (prosome, macropain) subunit, alpha type, 2, Proteasome component C3, proteasome subunit alpha type-2, proteasome subunit HC3, PSC3
Gene Symbols	PSMA2
Isotype	IgG
Test Specificity	This product is specific to Subunit or Isoform: alpha type-2.

Applications	Western Blot, Immunohistochemistry
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	P25787
Gene ID (Entrez)	5683
Immunogen	Synthetic peptides corresponding to PSMA2(proteasome (prosome, macropain) subunit, alpha type, 2) The peptide sequence was selected from the N terminal of PSMA2 (NP_002778), Peptide sequence VGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMGPDYRV.
Primary or Secondary	Primary
Molecular Weight of Antigen	26 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

PSMA2 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents