Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PSMB10/MECL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18866025UL
Description
PSMB10/MECL1 Polyclonal specifically detects PSMB10/MECL1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
PSMB10/MECL1 | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:2500-1:5000 | |
beta2i, FLJ00366, LMP10Proteasome subunit beta-2i, Low molecular mass protein 10, Macropain subunit MECl-1, MECL1EC 3.4.25.1, MGC1665, Multicatalytic endopeptidase complex subunit MECl-1, proteasome (prosome, macropain) subunit, beta type, 10, proteasome catalytic subunit 2i, Proteasome MECl-1, proteasome subunit beta 7i, proteasome subunit beta type-10, proteasome subunit MECL1 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
PSMB10 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:AGILGDLGSGGNVDACVITKTGAKLLRTLSSPTEPVKRSGRYHFVPGTTAVLTQTVKPLTLELVEETVQAMEVE | |
25 μL | |
Immunology | |
5699 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction