PSMB10/MECL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23815525UL

Catalog No. NB396954

Description

PSMB10/MECL1 Polyclonal specifically detects PSMB10/MECL1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PSMB10/MECL1
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: P40306
• Gene Symbols: PSMB10
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: FRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVT
• Quantity: 25 μL
• Research Discipline: Immunology
• Gene ID (Entrez): 5699
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: beta2i, FLJ00366, LMP10Proteasome subunit beta-2i, Low molecular mass protein 10, Macropain subunit MECl-1, MECL1EC 3.4.25.1, MGC1665, Multicatalytic endopeptidase complex subunit MECl-1, proteasome (prosome, macropain) subunit, beta type, 10, proteasome catalytic subunit 2i, Proteasome MECl-1, proteasome subunit beta 7i, proteasome subunit beta type-10, proteasome subunit MECL1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.