Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PSMD8 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP154588

 View more versions of this product

Catalog No. NBP154588


Add to cart

Description

Description

PSMD8 Polyclonal antibody specifically detects PSMD8 in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit samples. It is validated for Western Blot.
Specifications

Specifications

PSMD8
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
26S proteasome non-ATPase regulatory subunit 8, 26S proteasome regulatory subunit p31, HIP6,26S proteasome regulatory subunit S14, HYPF, MGC1660, Nin1p, p3126S proteasome regulatory subunit RPN12, proteasome (prosome, macropain) 26S subunit, non-ATPase, 8, Rpn12, S14
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
This product is specific to Subunit or Isoform: 8.
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat
Western Blot
Western Blot 1:100-1:2000
Affinity Purified
PSMD8
Synthetic peptides corresponding to PSMD8(proteasome (prosome, macropain) 26S subunit, non-ATPase, 8) The peptide sequence was selected from the C terminal of PSMD8. Peptide sequence DYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQLEMIV.
27 kDa
100 ul
Cell Cycle and Replication
Primary
5714
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit